PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g19440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family S1Fa-like
Protein Properties Length: 76aa    MW: 8056.74 Da    PI: 10.9176
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g19440genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA128.42e-40874268
       S1FA  2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavP 68
               ++a++eakGlnPGlivllv+ggll++fl++ny++y+yaqknlP +kkkPvskkklkreklkqGv+vP
  Tp4g19440  8 GKAAAEAKGLNPGLIVLLVIGGLLVTFLIANYAMYMYAQKNLPSKKKKPVSKKKLKREKLKQGVPVP 74
               57899*************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046891.1E-361274IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MSSEGSAGKA AAEAKGLNPG LIVLLVIGGL LVTFLIANYA MYMYAQKNLP SKKKKPVSKK  60
KLKREKLKQG VPVPSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3728922e-77AF372892.1 Arabidopsis thaliana At2g37120/T2N18.12 mRNA, complete cds.
GenBankAY0854392e-77AY085439.1 Arabidopsis thaliana clone 1517 mRNA, complete sequence.
GenBankBT0026692e-77BT002669.1 Arabidopsis thaliana At2g37120/T2N18.12 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565859.18e-27DNA-binding protein S1FA2
SwissprotQ423371e-28S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLW9SCA37e-21W9SCA3_9R
STRINGAT2G37120.13e-26(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769